pneumoniae (13). Moreover cathelicidins, such as CRAMP and defensins, constitute two important families of antimicrobial peptides (4). The evidence indicates

that cathelicidins are also likely to possess anti-mycoplasmal Alpelisib price activity. In the present study, we examined the antimicrobial activity of CRAMP against M. pneumoniae and the expression of CRAMP in BALF of M. pneumoniae-infected mice. To this end, we developed a sandwich ELISA to quantitate CRAMP levels. CRAMP was found to exert antimicrobial activity in vitro against M. pneumoniae. High concentrations of CRAMP were detected in BALF of M. pneumoniae-infected mice. Neutrophils in BALF showed a fair amount of CRAMP in their cytoplasm and M. pneumoniae caused the release

of CRAMP buy Erlotinib from neutrophils. Thus, our results suggest that CRAMP plays a critical role in protection against M. pneumoniae infection in a murine model. Mycoplasma pneumoniae FH and M. pneumoniae M129, originally clinical isolates, were cultured in PPLO medium (Becton Dickinson, Sparks, MD, USA) as described previously (14). These strains were centrifuged for 10 min at 20,000 g and washed with PBS twice. Then the cells were suspended to a concentration of 1 × 108 CFU/mL in PBS and subsequently used for antimicrobial assays and infection of mice. Cathelin-related antimicrobial peptide (C-terminus peptide) was chemically synthesized by Bex (Tokyo, Japan). The amino acid sequence is as follows; GLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPE. Rabbit anti-CRAMP Ab was prepared by immunizing rabbits with KLH-conjugated CRAMP peptide emulsified in complete Freund’s adjuvant. Repeated boosts were carried out every two weeks four times. Then sera were obtained and a MAbTrap Kit (Amersham Biosciences, Uppsala, Sweden) was used to isolate the IgG fraction. Mycoplasma pneumoniae strains prepared as above were diluted to 2 × 105 mL in 10 mM SPB (pH 7.4) containing 0.03% Luria-Bertani broth. The strains were harvested from an exponential phase culture. A 25-μL aliquot of M. pneumoniae

was incubated with 25 μL of CRAMP at various concentrations for 3 hr at 37°C dipyridamole as previously described (13). The mixture of M. pneumoniae and CRAMP was serially diluted 10-fold with SPB and plated on PPLO agar plates. Mycoplasmal colonies were enumerated the following day. BALB/c mice (5 weeks old) (Kyudo, Tosu, Saga, Japan) were intranasally infected with 50 μL of M. pneumoniae M129 (5 × 107 CFU) in PBS. After 24 hr, 1 mL of PBS was injected into the bronchial tracts of the mice and BALF obtained from them as previously described (15). After centrifugation of BALF at 400 g for 5 min, the supernatants were used for measurement of CRAMP concentration, whereas the cells of the pellets were used for detection of intracellular CRAMP antigens. All experimental procedures on animals were reviewed and approved by the Kurume University School of Medicine Institutional Animal Care and Use Committee.